Protein coding transcript 229940

• Transcript: Ll_transcript_54747
• CDS coordinates: 1-1287 (+)
• Peptide sequence: ICRVTKMLILSKLKPLIWRIQSQIENLALRVLGISKKVWLLEMVEKDKKNENLAYDTTINILKRLPVKSLVRFKCVSKDWLNLSNSPYFISLHLHHSTLLLLFQRIPLSNNQSQSSSSSSCLIGQDLKVHNPEFFDFALTDKIIGSCDGLLCVKHTNNHMLSILNPATREIRQVPEILHDIKSFSYFGFGFSPIVNDYKVVRISVSDEDRILDLDNIRVSLDLDDIRVTRAEVYSLTSGSWREIDATILQTLYLMSNSVTANGVMFWQAFATDPDAEILVSFDIGREMFTLLEGPPLLPSTSVTHSHTNVLAVHNNKLAMFHCFINGGIESCSIELWVLEDERWVKQYSVGPSARMLYPICIWRDEIVFREELYMRIGEYSAVETVLSLFNPYSDELKTLPAQKDRYYYVSFNYVESIVPVANVHHEQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_54747

• Blastp: Putative F-box/kelch-repeat protein At1g12870 from Arabidopsis with 26.79% of identity
• Blastx: Putative F-box protein At1g32420 from Arabidopsis with 27.03% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT1G12870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425469.1)
• Pfam: F-box domain (PF00646.32)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;