Transcript | Ll_transcript_54403 |
---|---|
CDS coordinates | 761-1492 (+) |
Peptide sequence | MAATNVKEMVLEGGFMMPHANSFGHTFRNYDAESERQEGVENFYRRNHINQSIDFVRKMREEYGKLKRVEMSIWECCELLNEVVDESDPDLDEPQIEHLLQTAEAIRKDYPNEDWLHLAGLIHDLGKVLLLPIFGGLPQWAVVGDTFPVGCRFDESIVHHKYFMENSDYNNPAYNTKYGIYSEKCGLNNVLMSWGHDDYMYLVSPSKTHVKLLFCLLSDHKVTSSNSRNGHSACRVKGAYIYT* |
ORF Type | complete |
Blastp | Inositol oxygenase 1 from Arabidopsis with 81.73% of identity |
---|---|
Blastx | Inositol oxygenase 1 from Arabidopsis with 81.73% of identity |
Eggnog | inositol oxygenase(ENOG410XQ4J) |
Kegg | Link to kegg annotations (AT1G14520) |
CantataDB | Link to cantataDB annotations (CNT0001463) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424836.1) |
Pfam | Myo-inositol oxygenase (PF05153.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer