Protein coding transcript 229978

• Transcript: Ll_transcript_54403
• CDS coordinates: 761-1492 (+)
• Peptide sequence: MAATNVKEMVLEGGFMMPHANSFGHTFRNYDAESERQEGVENFYRRNHINQSIDFVRKMREEYGKLKRVEMSIWECCELLNEVVDESDPDLDEPQIEHLLQTAEAIRKDYPNEDWLHLAGLIHDLGKVLLLPIFGGLPQWAVVGDTFPVGCRFDESIVHHKYFMENSDYNNPAYNTKYGIYSEKCGLNNVLMSWGHDDYMYLVSPSKTHVKLLFCLLSDHKVTSSNSRNGHSACRVKGAYIYT*
• ORF Type: complete

Annotations of Ll_transcript_54403

• Blastp: Inositol oxygenase 1 from Arabidopsis with 81.73% of identity
• Blastx: Inositol oxygenase 1 from Arabidopsis with 81.73% of identity
• Eggnog: inositol oxygenase(ENOG410XQ4J)
• Kegg: Link to kegg annotations (AT1G14520)
• CantataDB: Link to cantataDB annotations (CNT0001463)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424836.1)
• Pfam: Myo-inositol oxygenase (PF05153.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;