Protein coding transcript 230084

• Transcript: Ll_transcript_53087
• CDS coordinates: 70-510 (+)
• Peptide sequence: MEGVADSLNNAYQDFVTAAANVLQTKQNAGAQKTAATDAALENFKQKWESFKIACDQAEEFVESMKQRIGSECLVDEASGHASGKPGRATTTDLPPISAVRLEQMSKSVRWLVMELQHGSGTGAANSAPPHPSAAFDARFSEDAAQ*
• ORF Type: complete

Annotations of Ll_transcript_53087

• Blastp: Mediator of RNA polymerase II transcription subunit 32 from Arabidopsis with 61.29% of identity
• Blastx: Mediator of RNA polymerase II transcription subunit 32 from Arabidopsis with 60.78% of identity
• Eggnog: NA(ENOG4111V2K)
• Kegg: Link to kegg annotations (AT1G11760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438150.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;