Protein coding transcript 230130

• Transcript: Ll_transcript_54815
• CDS coordinates: 1-483 (+)
• Peptide sequence: KGTQSGLKPDKISSSSVRNQTGSDSEFVSLEDLAPLAMNKIEALSIEGLRIQSGMSEEDAPSNIVAQSIGDISALKGKGVDVSGSLGLEGAAGLQLLDVKDGSNNGVDGMIGLSLTLDEWMRLDAGEIDDMDNISEHTSKVLAAHHANSFDSIRGSSRGK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_54815

• Blastp: Protein PLASTID MOVEMENT IMPAIRED 1-RELATED 1 from Arabidopsis with 66.23% of identity
• Blastx: Protein PLASTID MOVEMENT IMPAIRED 1-RELATED 1 from Arabidopsis with 50.29% of identity
• Eggnog: NA(ENOG410Y9MA)
• Kegg: Link to kegg annotations (AT5G20610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417274.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;