Transcript | Ll_transcript_54815 |
---|---|
CDS coordinates | 1-483 (+) |
Peptide sequence | KGTQSGLKPDKISSSSVRNQTGSDSEFVSLEDLAPLAMNKIEALSIEGLRIQSGMSEEDAPSNIVAQSIGDISALKGKGVDVSGSLGLEGAAGLQLLDVKDGSNNGVDGMIGLSLTLDEWMRLDAGEIDDMDNISEHTSKVLAAHHANSFDSIRGSSRGK* |
ORF Type | 5prime_partial |
Blastp | Protein PLASTID MOVEMENT IMPAIRED 1-RELATED 1 from Arabidopsis with 66.23% of identity |
---|---|
Blastx | Protein PLASTID MOVEMENT IMPAIRED 1-RELATED 1 from Arabidopsis with 50.29% of identity |
Eggnog | NA(ENOG410Y9MA) |
Kegg | Link to kegg annotations (AT5G20610) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417274.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer