Protein coding transcript 2302

• Transcript: Ll_transcript_324658
• CDS coordinates: 1-546 (+)
• Peptide sequence: EDSAFSKLKAGFLNSLSDRQKVELLQFHTLSSFISISNFDTLTNPVQTQAGDDAQRLQLNVTTFGGNQVSMATGAVNATITGTVYADSKLAIYQVDKVLLPLDIVLPSKAPALAPAAAKKGGLSKTNSSSTDNSSSNVGGGDDESDSALPAEISAGYLSYKVGLMWVNFVVGTGLVGIAII*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_324658

• Blastp: Fasciclin-like arabinogalactan protein 11 from Arabidopsis with 52.8% of identity
• Blastx: Fasciclin-like arabinogalactan protein 12 from Arabidopsis with 58.42% of identity
• Eggnog: Arabinogalactan protein(ENOG410YFHZ)
• Kegg: Link to kegg annotations (AT5G03170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461293.1)
• Pfam: Fasciclin domain (PF02469.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;