Protein coding transcript 230273

• Transcript: Ll_transcript_166821
• CDS coordinates: 3-425 (-)
• Peptide sequence: HADLKDKPWWPQLQTVDELIQSSSTIIWIGSALHAAVNFGQYPYGGYILNRPTLSRRLIPEKGTPEYDELGTNPQKAYLRTITAKSEALVDLSVIEILSRHASDEIYLGQRDNPNWTSDTRALQAFKKFGTTLAEIDQNIT
• ORF Type: internal

Annotations of Ll_transcript_166821

• Blastp: Seed linoleate 9S-lipoxygenase-2 from Soja with 73.57% of identity
• Blastx: Seed linoleate 9S-lipoxygenase-2 from Soja with 73.57% of identity
• Eggnog: Plant lipoxygenase may be involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence or responses to wounding (By similarity)(ENOG410YN4N)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455488.1)
• Pfam: Lipoxygenase (PF00305.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;