Protein coding transcript 230445

• Transcript: Ll_transcript_168302
• CDS coordinates: 158-964 (+)
• Peptide sequence: MEVDPRQKLLSTKETAKEEEEELSLVKRVWEESKLMWIVAAPAIFTRSSTFGINVISQAFVGHIGSRELAAFALVYTVLIRFINGVLFGMASALSTLCGQAYGANEYGMMGVYLQRSWIVLTLTAIILLPLFIFTTPILILLGQDESIAEVAGTISLWSIPVMFAYIVSFTCQTFLQSQSKNIIIAFLAAFSISFHVCLSWLLIIKLNLGLPAAMVATSLAYWIPNIGQLIFVTCGWCNETWKGFSFLAFKELWPVVKLSLSAGAMLW*
• ORF Type: complete

Annotations of Ll_transcript_168302

• Blastp: Protein DETOXIFICATION 21 from Arabidopsis with 60.23% of identity
• Blastx: Protein DETOXIFICATION 21 from Arabidopsis with 61.67% of identity
• Eggnog: Mate efflux family protein(COG0534)
• Kegg: Link to kegg annotations (AT1G33110)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429240.1)
• Pfam: MatE (PF01554.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;