| Transcript | Ll_transcript_166393 |
|---|---|
| CDS coordinates | 195-632 (+) |
| Peptide sequence | MSSLLLRVSFGPIEDTNSLLGFACRSHIIERTQRRLKGVTFANKAVALSSAVVANPVISSEEKVYEVVLKQAALVKERNRDAKIALDLDSKPLENAEFSNGNLLNLAYDRCGEVCAEYAKTFYLGTSFSISSSFPTSLIHCPSLK* |
| ORF Type | complete |
| Blastp | Phytoene synthase, chloroplastic from Daucus sect. Daucus with 60.47% of identity |
|---|---|
| Blastx | Phytoene synthase 1, chloroplastic from Lycopersicon with 86.45% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019435350.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer