| Transcript | Ll_transcript_166420 |
|---|---|
| CDS coordinates | 816-1286 (+) |
| Peptide sequence | MSVTLLRTVLEVSSSARLFDSIRNAKLLGSSKFMSRDMGSIRAKQDKKKRRRFCSLSVNTNYACVGQPGLEGAGNFPLLSNVLINPAAGEVVVSSEQKVYDVVLKQASLVKRKLGSTDELEVKPDIALPGNLSLLSEAYDRCGQVCAEYAKTFYLG* |
| ORF Type | complete |
| Blastp | Phytoene synthase, chloroplastic from Cucumis with 48.61% of identity |
|---|---|
| Blastx | Phytoene synthase, chloroplastic from Cucumis with 61.86% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | Link to cantataDB annotations (CNT0001867) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019460948.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer