Protein coding transcript 230513

• Transcript: Ll_transcript_166425
• CDS coordinates: 303-1232 (+)
• Peptide sequence: MSVTLLRTVLEVSSSARLFDSIRNAKLLGSSKFMSRDMGSIRAKQDKKKRRRFCSLSVNTNYACVGQPGLEGAGNFPLLSNVLINPAAGEVVVSSEQKVYDVVLKQASLVKRKLGSTGEIEVKPEIALPGNLSLLSEAYDRCGEVCAEYAKTFYLGTLLMTPERKRAIWAIYVWCRRTDELVDGPNASHITPTALDRWESRLDELFQGRPFDMLDAALSDTVRKFPVDIQPFKDMIEGMRMDLKKSRYKNFDELYLYCYYVAGTVGLMSVPIMGISQYSQATTESVYNAALFLGIANQLTNILRDVGEE*
• ORF Type: complete

Annotations of Ll_transcript_166425

• Blastp: Phytoene synthase, chloroplastic from Cucumis with 69.13% of identity
• Blastx: Phytoene synthase, chloroplastic from Cucumis with 69.13% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001867)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460948.1)
• Pfam: Squalene/phytoene synthase (PF00494.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;