Transcript | Ll_transcript_166425 |
---|---|
CDS coordinates | 303-1232 (+) |
Peptide sequence | MSVTLLRTVLEVSSSARLFDSIRNAKLLGSSKFMSRDMGSIRAKQDKKKRRRFCSLSVNTNYACVGQPGLEGAGNFPLLSNVLINPAAGEVVVSSEQKVYDVVLKQASLVKRKLGSTGEIEVKPEIALPGNLSLLSEAYDRCGEVCAEYAKTFYLGTLLMTPERKRAIWAIYVWCRRTDELVDGPNASHITPTALDRWESRLDELFQGRPFDMLDAALSDTVRKFPVDIQPFKDMIEGMRMDLKKSRYKNFDELYLYCYYVAGTVGLMSVPIMGISQYSQATTESVYNAALFLGIANQLTNILRDVGEE* |
ORF Type | complete |
Blastp | Phytoene synthase, chloroplastic from Cucumis with 69.13% of identity |
---|---|
Blastx | Phytoene synthase, chloroplastic from Cucumis with 69.13% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0001867) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460948.1) |
Pfam | Squalene/phytoene synthase (PF00494.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer