Protein coding transcript 23053

• Transcript: Ll_transcript_366729
• CDS coordinates: 355-825 (+)
• Peptide sequence: MTLLETLRWNFHMLLHFLLLSTCLGIFRYAEKRWASKGGYHAATKLTDTIFNCNESPTGGTKSGIPRSRRLSLEESILVSHMAQVPPPVTRSREGSLDLPTKISVSPPIKRPSVSLDFDNLSGKSTGTVDPFGFNDKKSSSVPPSNWTTFDCKITIP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_366729

• Blastp: Probable ADP-ribosylation factor GTPase-activating protein AGD15 from Arabidopsis with 31.97% of identity
• Blastx: Probable ADP-ribosylation factor GTPase-activating protein AGD15 from Arabidopsis with 41.15% of identity
• Eggnog: domain, ankyrin repeat and PH domain(COG5347)
• Kegg: Link to kegg annotations (AT3G17660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430496.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;