Protein coding transcript 230546

• Transcript: Ll_transcript_168069
• CDS coordinates: 156-581 (+)
• Peptide sequence: MAPPPPAAVQGGEVPQVRQQQQQQGGFGITGIIRIAVFWYFASKFFSPKKPTQPSALISNLFQKSQPMDMWLYLSKHERFNDFGNEAALVWHETNIPYSVWGPKSTRLLTLKHQPSEALKHNGSLYAHVFFAHSGYSPDPSD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_168069

• Blastp: Cleft lip and palate transmembrane protein 1 homolog from Danio with 33.06% of identity
• Blastx: Cleft lip and palate transmembrane protein 1 homolog from Danio with 33.05% of identity
• Eggnog: cleft lip and palate(ENOG410XPEV)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433905.1)
• Pfam: Cleft lip and palate transmembrane protein 1 (CLPTM1) (PF05602.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;