Transcript | Ll_transcript_168069 |
---|---|
CDS coordinates | 156-581 (+) |
Peptide sequence | MAPPPPAAVQGGEVPQVRQQQQQQGGFGITGIIRIAVFWYFASKFFSPKKPTQPSALISNLFQKSQPMDMWLYLSKHERFNDFGNEAALVWHETNIPYSVWGPKSTRLLTLKHQPSEALKHNGSLYAHVFFAHSGYSPDPSD |
ORF Type | 3prime_partial |
Blastp | Cleft lip and palate transmembrane protein 1 homolog from Danio with 33.06% of identity |
---|---|
Blastx | Cleft lip and palate transmembrane protein 1 homolog from Danio with 33.05% of identity |
Eggnog | cleft lip and palate(ENOG410XPEV) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433905.1) |
Pfam | Cleft lip and palate transmembrane protein 1 (CLPTM1) (PF05602.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer