Transcript | Ll_transcript_168505 |
---|---|
CDS coordinates | 1544-2110 (+) |
Peptide sequence | MLVSLTAPKLCAKKFIGPHHFLGGRFVPPAIAEKYNLVLPPYPGTSMCVRIGKPPQVDISSLRENYISPEFLEEQAEADPINQFHKWFGDALAVGLKEPNAMALSTVGKDGKPSSRMVLLKGVDKHDFVWYTNYESQKARELSENPYASLLFHWDGLNRQVITLFIVGSHFLKLICSHMDLDATKVNF* |
ORF Type | complete |
Blastp | Pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic from Arabidopsis with 74.53% of identity |
---|---|
Blastx | Pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic from Arabidopsis with 74.42% of identity |
Eggnog | NADHX epimerase activity(COG0062) |
Kegg | Link to kegg annotations (AT5G49970) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433998.1) |
Pfam | Pyridoxamine 5'-phosphate oxidase (PF01243.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer