Protein coding transcript 230551

• Transcript: Ll_transcript_168511
• CDS coordinates: 3057-3623 (+)
• Peptide sequence: MLVSLTAPKLCAKKFIGPHHFLGGRFVPPAIAEKYNLVLPPYPGTSMCVRIGKPPQVDISSLRENYISPEFLEEQAEADPINQFHKWFGDALAVGLKEPNAMALSTVGKDGKPSSRMVLLKGVDKHDFVWYTNYESQKARELSENPYASLLFHWDGLNRQVITLFIVGSHFLKLICSHMDLDATKVNF*
• ORF Type: complete

Annotations of Ll_transcript_168511

• Blastp: Pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic from Arabidopsis with 74.53% of identity
• Blastx: Pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic from Arabidopsis with 74.42% of identity
• Eggnog: NADHX epimerase activity(COG0062)
• Kegg: Link to kegg annotations (AT5G49970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433998.1)
• Pfam: Pyridoxamine 5'-phosphate oxidase (PF01243.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;