Protein coding transcript 230555

• Transcript: Ll_transcript_168495
• CDS coordinates: 3154-3495 (+)
• Peptide sequence: MLVSLTAPKLCAKKFIGPHHFLGGRFVPPAIAEKYNLVLPPYPGTSMCVRIGKPPQVDISSLRENYISPEFLEEQAEADPINQFHKWFGDALAVGLKEPNAMALSTVGKDGKP*
• ORF Type: complete

Annotations of Ll_transcript_168495

• Blastp: Pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic from Arabidopsis with 76.11% of identity
• Blastx: Pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic from Arabidopsis with 75.45% of identity
• Eggnog: NADHX epimerase activity(COG0062)
• Kegg: Link to kegg annotations (AT5G49970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003522762.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;