Protein coding transcript 230563

• Transcript: Ll_transcript_168688
• CDS coordinates: 2057-3373 (+)
• Peptide sequence: MNRVIGSIRILSISLIPLNVLLNSQRLQDTVAQCTIMNSSTEVVSGSEDGSHVFEAIGLLIGMEDVPPEKQSDYLSSLLHPLCQQVETLLINAKLLTYEETNAKISIVQQIIMEINSLSKGFSERLVTTSRPAIGVMFKQTLDVLLQVLVVFPKVEPLRSKVTSFIHRMVDTLGASVFPFLPKALEQMLAETQPREMIGFLMLLNQLICKFSTSVHAIVEEIFPAVADRIFSVIPRDGLPAGSGAVTEEIRELQELQRTLYTFLHVITTHDLSSVFLTPKSKAYLDPVMQLLLYSSCNHKDILVRKACVQIFTRLIKDWCAEPYEEKVPGFRTFMIESFGINCCLYSVLDRSFELRDTNTFVLFGDIVLAQKVMYEKFGNDFLVHFVSKGFSAAHCPPDLAEQYSQKLQGSDIKALKSFYQSLVENLRLQQNGSLVFR*
• ORF Type: complete

Annotations of Ll_transcript_168688

• Blastp: Exportin-T from Arabidopsis with 69.52% of identity
• Blastx: Exportin-T from Arabidopsis with 68.58% of identity
• Eggnog: tRNA nucleus export receptor which facilitates tRNA translocation across the nuclear pore complex. Involved in pre- tRNA splicing, probably by affecting the interaction of pre-tRNA with splicing endonuclease (By similarity)(ENOG410XZDZ)
• Kegg: Link to kegg annotations (AT1G72560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423350.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;