Protein coding transcript 2306

• Transcript: Ll_transcript_283970
• CDS coordinates: 3-593 (+)
• Peptide sequence: RNLLVMLGGPNFPVFLGRRDGTVSTSSSVNNHLPKPTMPMSHIIDIFTQRGFTVEEFVALTGAHTVGLTHCSEIFNNENKNIIHNNDYGYNPRFAEALQKACGNYKNDPTLSVFNDIMTPGKFDNMYFQNLPKGLGVLKSDHGLYSDNRTKPFVERFGKDENEFFRVFAKSMQKLSFLGVKTGRRGEIRRRCDQIN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_283970

• Blastp: Peroxidase 63 from Arabidopsis with 63.27% of identity
• Blastx: Peroxidase 63 from Arabidopsis with 62.76% of identity
• Eggnog: peroxidase(ENOG4111FDS)
• Kegg: Link to kegg annotations (AT5G40150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453226.1)
• Pfam: Peroxidase (PF00141.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;