| Transcript | Ll_transcript_166248 |
|---|---|
| CDS coordinates | 1-375 (+) |
| Peptide sequence | YWPLIYIIILYLCMQAVCFREIDDVAALEEKLGRPLSKQERSRIGVSKLRFFLEELLQKRYIRSVPLIIPLLEKQYRGATRKLSDINQELSTLDESKLKEKGRAFHDLFLTKVSVPEFDFLLII* |
| ORF Type | 5prime_partial |
| Blastp | Dynamin-like protein ARC5 from Arabidopsis with 68.82% of identity |
|---|---|
| Blastx | Dynamin-like protein ARC5 from Arabidopsis with 75.18% of identity |
| Eggnog | Dynamin family(COG0699) |
| Kegg | Link to kegg annotations (AT3G19720) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_006580830.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer