Protein coding transcript 230603

• Transcript: Ll_transcript_166213
• CDS coordinates: 2021-2656 (+)
• Peptide sequence: MQHKEFIILCLEDCSDWSNATTRRIVMQIDPELSRTVIVSTKLDTRIPQFARPSDVEVFLSPPACTLDSCILGDSPFFTSVPSGRVGSGSDSLYRSNDEFKQAVCFREIDDVAALEEKLGRPLSKQERSRIGVSKLRFFLEELLQKRYIRSVPLIIPLLEKQYRGATRKLSDINQELSTLDESKLKEKGRAFHDLFLTKVSVPEFDFLLII*
• ORF Type: complete

Annotations of Ll_transcript_166213

• Blastp: Dynamin-like protein ARC5 from Arabidopsis with 76.29% of identity
• Blastx: Dynamin-like protein ARC5 from Arabidopsis with 78.33% of identity
• Eggnog: Dynamin family(COG0699)
• Kegg: Link to kegg annotations (AT3G19720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429278.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;