Protein coding transcript 230604

• Transcript: Ll_transcript_166251
• CDS coordinates: 94-486 (+)
• Peptide sequence: MELGSSEEDAREEQQCLYEAYNELHSLAQDLHTPFDAPAVLVVGHQTDGKSALVEALMGFQFNHVGGGTKTRRPITLHMKYEPQCDSPHCYLLSDLDPTLYHHKSPSNSERTTVKTKALVSFHKHILKLKM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_166251

• Blastp: Dynamin-like protein ARC5 from Arabidopsis with 72.64% of identity
• Blastx: Dynamin-like protein ARC5 from Arabidopsis with 72.64% of identity
• Eggnog: Dynamin family(COG0699)
• Kegg: Link to kegg annotations (AT3G19720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429278.1)
• Pfam: Dynamin family (PF00350.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;