Transcript | Ll_transcript_166222 |
---|---|
CDS coordinates | 541-1089 (+) |
Peptide sequence | MTLPSIKAPPPSKETRTCEADEEHNKQALTVAIASAAEAAITAAHVAVEVVRLNYAHQCKEKQEEFQSAKTKHGAAPQSTYQWETEECSAIKIQTAFRGYLARKALKALKGIVKLQAIIRGRSVRRQAMSTLKCLQSIVNIQSQVCARRLQMVEGKCECDENEGMEGSKDRIIRVGIIKSYT* |
ORF Type | complete |
Blastp | Protein IQ-DOMAIN 14 from Arabidopsis with 46.84% of identity |
---|---|
Blastx | Protein IQ-DOMAIN 14 from Arabidopsis with 46.84% of identity |
Eggnog | IQ calmodulin-binding motif(ENOG4111DSA) |
Kegg | Link to kegg annotations (AT2G43680) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432618.1) |
Pfam | IQ calmodulin-binding motif (PF00612.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer