| Transcript | Ll_transcript_166963 |
|---|---|
| CDS coordinates | 507-905 (+) |
| Peptide sequence | MVAGGLAGDTPHMISSAAKGLARLTYEFSDLVLTALDWLPSTFLLLQRKNKEIIKANLALLKVLVAKSQAEVLQVHLRNMVEGLLNWQDNTKNHFKAKVAIFVILCDFLMQYLLLMDVLELSYSHILSILRFI |
| ORF Type | 3prime_partial |
| Blastp | Ribosomal RNA-processing protein 12 from Saccharomyces with 30.69% of identity |
|---|---|
| Blastx | Ribosomal RNA-processing protein 12 from Saccharomyces with 26.63% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (YPL012W) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019455321.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer