Protein coding transcript 230676

• Transcript: Ll_transcript_167637
• CDS coordinates: 360-968 (+)
• Peptide sequence: MADISKEELFQVIKRLTLKISNLFSISPDDVNSQSIGAVAALAVAIFFIWRLLRSTGGTQHIQRKPQATTSASHGVSAQTNASVAPSGIRSPLDNSRAQNVVDELFQPVKPTLGQIVRQRLSEGRKVTCCLLGVILEESRPEDLQKQATVKSSVLELLLEITKFCDLYLMERVLDDESEVCHLSRYIIYQSCVNCLYVLDVVH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_167637

• Blastp: Peroxisome biogenesis protein 22 from Arabidopsis with 55.43% of identity
• Blastx: Peroxisome biogenesis protein 22 from Arabidopsis with 55.43% of identity
• Eggnog: peroxisome biogenesis protein 22-like(ENOG410XXC3)
• Kegg: Link to kegg annotations (AT3G21865)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448956.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;