Protein coding transcript 230677

• Transcript: Ll_transcript_167638
• CDS coordinates: 1654-2490 (+)
• Peptide sequence: MGVIEEADTSSKQQNLFHLIKRYGSYLSLNISNFFSSFSLYNLDIRSIGAIAGLAVAIVFTWRLLRSPAGGPQQRRQKRQGSSSSNPGLTSHSDASVVPSEIYDSRAQNVVDELFQPLKPTLGQIVRQRLSEGRKVTCRLLGVILEESSPEELQKQATVKSSVLEVLLEITKFCDLYLMERVLDDESEKRVLVALEEAGVFTSGGLVKDKVLFCSTENGRTSFVRQLEPNWHIDTNPEIVTQLARFIKYQIHVSPVRSERSAANVFSAISLEQFFGSI*
• ORF Type: complete

Annotations of Ll_transcript_167638

• Blastp: Peroxisome biogenesis protein 22 from Arabidopsis with 63.6% of identity
• Blastx: Peroxisome biogenesis protein 22 from Arabidopsis with 64.64% of identity
• Eggnog: peroxisome biogenesis protein 22-like(ENOG410XXC3)
• Kegg: Link to kegg annotations (AT3G21865)
• CantataDB: Link to cantataDB annotations (CNT0000314)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458481.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;