Transcript | Ll_transcript_167622 |
---|---|
CDS coordinates | 1654-2490 (+) |
Peptide sequence | MGVIEEADTSSKQQNLFHLIKRYGSYLSLNISNFFSSFSLYNLDIRSIGAIAGLAVAIVFTWRLLRSPAGGPQQRRQKRQGSSSSNPGLTSHSDASVVPSEIYDSRAQNVVDELFQPLKPTLGQIVRQRLSEGRKVTCRLLGVILEESSPEELQKQATVKSSVLEVLLEITKFCDLYLMERVLDDESEKRVLVALEEAGVFTSGGLVKDKVLFCSTENGRTSFVRQLEPNWHIDTNPEIVTQLARFIKYQIHVSPVRSERSAANVFSAISLEQFFGSI* |
ORF Type | complete |
Blastp | Peroxisome biogenesis protein 22 from Arabidopsis with 63.6% of identity |
---|---|
Blastx | Peroxisome biogenesis protein 22 from Arabidopsis with 64.64% of identity |
Eggnog | peroxisome biogenesis protein 22-like(ENOG410XXC3) |
Kegg | Link to kegg annotations (AT3G21865) |
CantataDB | Link to cantataDB annotations (CNT0000314) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458481.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer