Protein coding transcript 230697

• Transcript: Ll_transcript_168525
• CDS coordinates: 1370-2215 (+)
• Peptide sequence: MLTRTCMFGESCKFDHPVWVPEGGIPDWKEVPDVTTETLPERPGEPDCPYFVKTQRCKFGPRCKFNHPKVSSESAGVSDLPDRPSEPPCAFYVKTGRCKFGAACKFDHPKDIQIQLSGELNHAAEQTQTSFMMEGATVDTQTTLTSPLFQNSKGLPVRLGEVDCPFYMKTGSCKYGASCRYNHPDRTAINPPIAALGPSVLASSAANLNIGLINPAAPVYQAFDPRLSNPMVMLIAYTSWMESSFYLNKYVIIGTWYMRLTHNRLNLLVLTPGIWNAAVPT*
• ORF Type: complete

Annotations of Ll_transcript_168525

• Blastp: Zinc finger CCCH domain-containing protein 37 from Arabidopsis with 57.72% of identity
• Blastx: Zinc finger CCCH domain-containing protein 37 from Arabidopsis with 59.87% of identity
• Eggnog: zinc finger CCCH domain-containing protein(ENOG410YAW6)
• Kegg: Link to kegg annotations (AT3G12680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449302.1)
• Pfam: RNA-binding, Nab2-type zinc finger (PF14608.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;