Transcript | Ll_transcript_168185 |
---|---|
CDS coordinates | 458-985 (+) |
Peptide sequence | MSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYSALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPKGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEF |
ORF Type | 3prime_partial |
Blastp | Tubulin beta chain from Soja with 99.43% of identity |
---|---|
Blastx | Tubulin beta chain from Soja with 99.46% of identity |
Eggnog | protein polymerization(COG5023) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440119.1) |
Pfam | Tubulin C-terminal domain (PF03953.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer