Protein coding transcript 230762

• Transcript: Ll_transcript_168986
• CDS coordinates: 138-1049 (+)
• Peptide sequence: MTTTNTMQYKNLGRSGLRVSQLSYGAWVSFGNQLDVKEAKSLMQCCRDHGVNFFDNAEVYANGRAEEIMGQAIRELGWKRSDLVVSTKIFWGGQGPNDKGLSRKHIIEGTKASLKRLDMEYVDVIYCHRPDTTTPIEETVRAMNYVIDNGWAFYWGTSEWTAQQITEAWSVAQRLDLIGPIVEQPEYNLLSRHKVESEFLPLYDNYGIGLTTWSPLSSGVLTGKYKKGAIPPDSRFALENYKNLATRSLVDDVLKKVDGLKPIADELGVPLSQLAIAWCANNPNVSSVICGATKESQVSYHML*
• ORF Type: complete

Annotations of Ll_transcript_168986

• Blastp: Probable voltage-gated potassium channel subunit beta from Arabidopsis with 85.47% of identity
• Blastx: Probable voltage-gated potassium channel subunit beta from Arabidopsis with 85.47% of identity
• Eggnog: Aldo keto reductase(COG0667)
• Kegg: Link to kegg annotations (AT1G04690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432797.1)
• Pfam: Aldo/keto reductase family (PF00248.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;