Transcript | Ll_transcript_366902 |
---|---|
CDS coordinates | 717-1073 (+) |
Peptide sequence | MGWLSKIFKTSDHKISEGHYHNNHSNYKDDADSYTPSTSGDVWPKSEDEDIDRAIALSLVEENQKGNGVNDYKSQLEEDEQLARAIEQSLIVESPPRPRYGNENMHQPVPLYFPMGYR* |
ORF Type | complete |
Blastp | Protein DA1 from Arabidopsis with 40.48% of identity |
---|---|
Blastx | Protein DA1 from Arabidopsis with 79.83% of identity |
Eggnog | PDZ and LIM domain(ENOG410XRD4) |
Kegg | Link to kegg annotations (AT1G19270) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458702.1) |
Pfam | Ubiquitin interaction motif (PF02809.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer