Transcript | Ll_transcript_168381 |
---|---|
CDS coordinates | 108-662 (+) |
Peptide sequence | MLARLAGNRFNQIRHVFHQPSRTFSTALNYHLDSPDNKPDLPWEYSDANKTKVKEILSHYPSNYKQSAVIPLLDLAQQQHGGWLPVSAMNAVAKVVEVAPIRVYEVATFYSMFNRAKVGKYHLLVCGTTPCMIRGSRGIEEALLKHLGVKRNEVTQDGLFSVGEMECMVSLFFEQDVALISALS* |
ORF Type | complete |
Blastp | NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial from Arabidopsis with 84.88% of identity |
---|---|
Blastx | NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial from Arabidopsis with 84.88% of identity |
Eggnog | Nadh dehydrogenase(COG1905) |
Kegg | Link to kegg annotations (AT4G02580) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436344.1) |
Pfam | Thioredoxin-like [2Fe-2S] ferredoxin (PF01257.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer