Protein coding transcript 23081

• Transcript: Ll_transcript_366903
• CDS coordinates: 515-841 (+)
• Peptide sequence: MFNVQEGVCDHIALRVMGWLSKIFKTSDHKISEGHYHNNHSNYKDDADSYTPSTSGDVWPKSEDEDIDRAIALSLVEENQKGNGVNDYKSQLEENQKGNGVNDYKSQLE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_366903

• Blastp: Protein DA1 from Arabidopsis with 37.14% of identity
• Blastx: Protein DA1 from Arabidopsis with 39.78% of identity
• Eggnog: PDZ and LIM domain(ENOG410XRD4)
• Kegg: Link to kegg annotations (AT1G19270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458702.1)
• Pfam: Ubiquitin interaction motif (PF02809.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;