Protein coding transcript 230863

• Transcript: Ll_transcript_167110
• CDS coordinates: 193-552 (+)
• Peptide sequence: MVFPNQSMLVSDQRKINGRGKIEIKRIENITNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVKASIERYKKANSDSSSAGSTSEANAQVYIFLAHSLFQYFFQ*
• ORF Type: complete

Annotations of Ll_transcript_167110

• Blastp: Floral homeotic protein AGAMOUS from Nicotiana with 88.66% of identity
• Blastx: Floral homeotic protein AGAMOUS from Nicotiana with 92.31% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107812878)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462650.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;