Protein coding transcript 230864

• Transcript: Ll_transcript_167115
• CDS coordinates: 316-669 (+)
• Peptide sequence: MMGEALSPMNAKELKSLETKLEKGISRIRSKKNELLFAEIEYMQKREIDLHNNNQLLRAKIAESERSHHNINVLPGVPNYESMESQQQFDSRGYFQVNGLQPNNQYGRQDHMSLQLT*
• ORF Type: complete

Annotations of Ll_transcript_167115

• Blastp: Floral homeotic protein AGAMOUS from Panax with 67.52% of identity
• Blastx: Floral homeotic protein AGAMOUS from Panax with 67.23% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462646.1)
• Pfam: K-box region (PF01486.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;