Protein coding transcript 230865

• Transcript: Ll_transcript_167118
• CDS coordinates: 193-924 (+)
• Peptide sequence: MVFPNQSMLVSDQRKINGRGKIEIKRIENITNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVKASIERYKKANSDSSSAGSTSEANAQFYQQEAAKLRVQISNLQNHNRQMMGEALSPMNAKELKSLETKLEKGISRIRSKKNELLFAEIEYMQKREIDLHNNNQLLRAKIAESERSHHNINVLPGVPNYESMESQQQFDSRGYFQVNGLQPNNQYGRQDHMSLQLT*
• ORF Type: complete

Annotations of Ll_transcript_167118

• Blastp: Floral homeotic protein AGAMOUS from Nicotiana with 74.48% of identity
• Blastx: Floral homeotic protein AGAMOUS from Panax with 72.61% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107812878)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462646.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;