Transcript | Ll_transcript_167129 |
---|---|
CDS coordinates | 4175-4528 (+) |
Peptide sequence | MMGEALSPMNAKELKSLETKLEKGISRIRSKKNELLFAEIEYMQKREIDLHNNNQLLRAKIAESERSHHNINVLPGVPNYESMESQQQFDSRGYFQVNGLQPNNQYGRQDHMSLQLT* |
ORF Type | complete |
Blastp | Floral homeotic protein AGAMOUS from Panax with 67.52% of identity |
---|---|
Blastx | Floral homeotic protein AGAMOUS from Petunia with 62.64% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462646.1) |
Pfam | K-box region (PF01486.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer