Protein coding transcript 23090

• Transcript: Ll_transcript_366899
• CDS coordinates: 717-1211 (+)
• Peptide sequence: MGWLSKIFKTSDHKISEGHYHNNHSNYKDDADSYTPSTSGDVWPKSEDEDIDRAIALSLVEENQKGNGVNDYKSQLEEDEQLARAIEQSLIVESPPRPRYGNENMHQPVPLYFPMGYRVCAGCNTEIGYGRYLNCLNTFWHPECFRCRACNLPISDYEFSTSGNY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_366899

• Blastp: Protein DA1 from Arabidopsis with 42.86% of identity
• Blastx: Protein DA1 from Arabidopsis with 42.86% of identity
• Eggnog: PDZ and LIM domain(ENOG410XRD4)
• Kegg: Link to kegg annotations (AT1G19270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458702.1)
• Pfam: Ubiquitin interaction motif (PF02809.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;