Protein coding transcript 2310

• Transcript: Ll_transcript_284030
• CDS coordinates: 531-839 (+)
• Peptide sequence: MPASLTIIEVHQDEVFEVPLGAEVIASSDKTAVEMFAISDHILGIQGHPEYTKDILYNLVDRLLNQDLIQKDYAEDVKCKLEIAEPDRKCWEKICRNFLKGI*
• ORF Type: complete

Annotations of Ll_transcript_284030

• Blastp: Gamma-glutamyl peptidase 3 from Arabidopsis with 54.46% of identity
• Blastx: Gamma-glutamyl peptidase 5 from Arabidopsis with 47.92% of identity
• Eggnog: Catalyzes the synthesis of GMP from XMP (By similarity)(COG0518)
• Kegg: Link to kegg annotations (AT4G30550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414432.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;