Transcript | Ll_transcript_166491 |
---|---|
CDS coordinates | 1-489 (+) |
Peptide sequence | MDRGDQMALSGSASYYMQREMPGSGTQPELHNSPNIRPMSNPNVPFQSTIGGGTLGSTFPMDSTGIQSQSVNVGAPSGVPSGTPVKRKRGRPRKYGTDGTVSLTLTPSPTLASHPGTLTQTQSQKRGRGRPPGSGKKQQLASVGISLLQLWFCRVLNKNIYN* |
ORF Type | complete |
Blastp | AT-hook motif nuclear-localized protein 9 from Arabidopsis with 47.77% of identity |
---|---|
Blastx | AT-hook motif nuclear-localized protein 9 from Arabidopsis with 43.75% of identity |
Eggnog | AT hook motif domain containing protein, expressed(ENOG410YDXW) |
Kegg | Link to kegg annotations (AT2G45850) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456526.1) |
Pfam | AT hook motif (PF02178.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer