Protein coding transcript 231026

• Transcript: Ll_transcript_166494
• CDS coordinates: 1-492 (+)
• Peptide sequence: MDRGDQMALSGSASYYMQREMPGSGTQPELHNSPNIRPMSNPNVPFQSTIGGGTLGSTFPMDSTGIQSQSVNVGAPSGVPSGTPVKRKRGRPRKYGTDGTVSLTLTPSPTLASHPGTLTQTQSQKRGRGRPPGSGKKQQLASLGKSLLQLFCCVLNKIIIIGS*
• ORF Type: complete

Annotations of Ll_transcript_166494

• Blastp: AT-hook motif nuclear-localized protein 9 from Arabidopsis with 46.84% of identity
• Blastx: AT-hook motif nuclear-localized protein 9 from Arabidopsis with 67.16% of identity
• Eggnog: AT hook motif domain containing protein, expressed(ENOG410YDXW)
• Kegg: Link to kegg annotations (AT2G45850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456526.1)
• Pfam: AT hook motif (PF02178.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;