Protein coding transcript 2311

• Transcript: Ll_transcript_284031
• CDS coordinates: 209-955 (+)
• Peptide sequence: MRIEGRKFALFQAAKDSDYVKKIYGGYFNVYVEAFGEKGEKWELFKVYEGEFPDFNELHKYDGFVVSGSPNDAYANDYWILKLCFLLQTLDAMEKKVLGICFGHQVLCRALGGRVGKAYTGWDIGTRQVSFVKELAPYSYLEHLEEMPASLTIIEVHQDEVFEVPLGAEVIASSDKTAVEMFAISDHILGIQGHPEYTKDILYNLVDRLLNQDLIQKDYAEDVKCKLEIAEPDRKCWEKICRNFLKGI*
• ORF Type: complete

Annotations of Ll_transcript_284031

• Blastp: Gamma-glutamyl peptidase 5 from Arabidopsis with 55.24% of identity
• Blastx: Gamma-glutamyl peptidase 5 from Arabidopsis with 55.24% of identity
• Eggnog: Catalyzes the synthesis of GMP from XMP (By similarity)(COG0518)
• Kegg: Link to kegg annotations (AT2G23970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414432.1)
• Pfam: Glutamine amidotransferase class-I (PF00117.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;