Protein coding transcript 231218

• Transcript: Ll_transcript_167363
• CDS coordinates: 136-561 (+)
• Peptide sequence: MASPADSPKTDSHSEFTSDSPVNSVADVISPPNSSNAVVPASSSTSPAVCLLRFAADSAGGALMGSIFGYGSGLFKKKGFKGSFAEAGSHAKTFAVLSGVHSLVVCILTRLRGKNDVINAGVAGCCTGLALSFPGINFLLI*
• ORF Type: complete

Annotations of Ll_transcript_167363

• Blastp: Mitochondrial import inner membrane translocase subunit TIM22-2 from Arabidopsis with 65.19% of identity
• Blastx: Mitochondrial import inner membrane translocase subunit TIM22-2 from Arabidopsis with 83.72% of identity
• Eggnog: mitochondrial import inner membrane translocase, subunit(COG5596)
• Kegg: Link to kegg annotations (AT4G26670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442880.1)
• Pfam: Tim17/Tim22/Tim23/Pmp24 family (PF02466.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;