Transcript | Ll_transcript_168564 |
---|---|
CDS coordinates | 436-1014 (+) |
Peptide sequence | MFSRPRDPSAFSIFKWKRQDESSVTTGLLQDVLPEIELSDYRRIPSPGSESPSGLLNGESLNAEPIPDLDLFFERLYSYYCEKGLWCIIIKWIVELLSLGFTICFSGFFLLYVDWNGLRNAKCGMNAVESGIKPCDLAKEALHQYPLTPLTLNKSIIVGYLGIFSIYWIFCFLRFFAQLKYTLEIRQFYYNR* |
ORF Type | complete |
Blastp | Autophagy-related protein 9 from Arabidopsis with 72.4% of identity |
---|---|
Blastx | Autophagy-related protein 9 from Arabidopsis with 72.4% of identity |
Eggnog | Involved in autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation. Plays a key role in the organization of the preautophagosomal structure phagophore assembly site (PAS), the nucleating site for formation of the sequestering vesicle. Cycles between the PAS and the cytoplasmic vesicle pool and may participate in supplying membrane for the growing autophagosome(ENOG410XQBE) |
Kegg | Link to kegg annotations (AT2G31260) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433827.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer