Transcript | Ll_transcript_167925 |
---|---|
CDS coordinates | 2086-2955 (+) |
Peptide sequence | MQHLYKNQLQNYAHKKNLNLPAYSSEWEGPPHALRFKCKVTIDGQTFESSKFFSTLKDAEHAAAEVALMSLSPGGVQEDQTGLYKNLLQEFAQKEGFRLPSYNTNRYGESHMPTFVSQVEIEGESFTGQEAKSKKQAETSAAKVAYMTLKERKAHCGQAPDFSSDCSEANVITGLQHHANLRSPVSPGLVAKNHLDKSKEPVAFTEKKGSCSSSSGNSNGCTKNSSLTNAQSEPSLSESSNVISDTSKMASSCRVKVIVYSRNTNVEIEGGGSIMPISDDKWLAYSFSH* |
ORF Type | complete |
Blastp | Double-stranded RNA-binding protein 4 from Arabidopsis with 54.76% of identity |
---|---|
Blastx | Double-stranded RNA-binding protein 4 from Arabidopsis with 55.36% of identity |
Eggnog | Double-stranded RNA binding motif(ENOG410YPSH) |
Kegg | Link to kegg annotations (AT3G62800) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427615.1) |
Pfam | Double-stranded RNA binding motif (PF00035.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer