Protein coding transcript 231478

• Transcript: Ll_transcript_166882
• CDS coordinates: 2-325 (+)
• Peptide sequence: GREVAVKRLAKTSGQGTVEFKNELMLICELQHTNLVQLIGCCIGEYERILIYEYMSNKSLDFFLFDSTRSNLLNWRKRLNIIEGISQGLLYLHKYSRLKIIHRDLKA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_166882

• Blastp: G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520 from Arabidopsis with 70.09% of identity
• Blastx: G-type lectin S-receptor-like serine/threonine-protein kinase CES101 from Arabidopsis with 68.75% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT1G67520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432341.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;