Protein coding transcript 23151

• Transcript: Ll_transcript_365627
• CDS coordinates: 335-859 (+)
• Peptide sequence: MHACAGELRGIFKLLACEFRSRVRLRDLGTVLHLISAIMTSVHDLTDNEADRQQQSESEMQPSSENGISDPGLSTQNVQYAMPAQLGTGHAMAPPVYPYQDPYYRSIFAPYATQPYPPPPYGGQPMVQLQLMGMQQAGVPLPTDAVEEPVFVNAKQYHGILRRRQSRAKAESENK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_365627

• Blastp: Nuclear transcription factor Y subunit A-7 from Arabidopsis with 56.43% of identity
• Blastx: Nuclear transcription factor Y subunit A-7 from Arabidopsis with 68.54% of identity
• Eggnog: Nuclear transcription factor Y(COG5224)
• Kegg: Link to kegg annotations (AT1G30500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461537.1)
• Pfam: CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B (PF02045.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;