Protein coding transcript 231538

• Transcript: Ll_transcript_166108
• CDS coordinates: 142-660 (+)
• Peptide sequence: MRIFRKLTTPSNYHHHHQLRSYVSTCRAVVLPSFGGADKLQLRSDVPVPPLKPNHVLVRTRAVSINPLDTRMRSGYGRSIFEPLLPLILGRDVSGEVAAVGESVRSVSVGQEVFGALHPTAVRGTYTDYAILSDEEVTPKPTSLSHVVCVYLYVFFSFVIFGKLHWLHWGVS*
• ORF Type: complete

Annotations of Ll_transcript_166108

• Blastp: Reticulon-4-interacting protein 1 homolog, mitochondrial from Dictyostelium with 36.59% of identity
• Blastx: Reticulon-4-interacting protein 1 homolog, mitochondrial from Dictyostelium with 36.59% of identity
• Eggnog: alcohol dehydrogenase(COG0604)
• Kegg: Link to kegg annotations (DDB_G0288729)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443914.1)
• Pfam: Alcohol dehydrogenase GroES-like domain (PF08240.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;