Protein coding transcript 231569

• Transcript: Ll_transcript_168327
• CDS coordinates: 256-699 (+)
• Peptide sequence: MDRCFRFFPCLVDPGRRSSLWLKLAFVTIHVVYIAILFLFDGDLVEKTRKEPWYTALYLLLCAVTLIQYFATSIASPGYALNAMRAVNERNAVYRQTSETSNQSASSRNGSFIVTVEGNLIGRNVSGSNASDWSKLVADLYSASPIR*
• ORF Type: complete

Annotations of Ll_transcript_168327

• Blastp: Protein S-acyltransferase 10 from Arabidopsis with 50.71% of identity
• Blastx: Protein S-acyltransferase 10 from Arabidopsis with 48.63% of identity
• Eggnog: Zinc finger, DHHC-type containing(COG5273)
• Kegg: Link to kegg annotations (AT3G51390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421300.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;