Protein coding transcript 231591

• Transcript: Ll_transcript_169194
• CDS coordinates: 1370-2074 (+)
• Peptide sequence: MDTFPQKLDLLLSDAASRFKDFKYGPEVLKEEVENYKRYAERLEPYIDDTVHVINDAIAQKKKILVEGGQATMLDIDFGTYPFVTSSSPSAGGICTGLGIAPRAIGDLIGVVKAYTTRVGSGPFPTELLGPAGDQLRSAGHEFGTTTGRPRRCGWLDLVALRFSCQINGFSSLNLTKLDVLSELDEIQLGVAYKHADGTTINSFPSDLDVLEQLKVNVPSFPFTAFLHLPPSSQ*
• ORF Type: complete

Annotations of Ll_transcript_169194

• Blastp: Adenylosuccinate synthetase 2, chloroplastic from Ricinus with 83.78% of identity
• Blastx: Adenylosuccinate synthetase 2, chloroplastic from Ricinus with 85.71% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (8278953)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425935.1)
• Pfam: Adenylosuccinate synthetase (PF00709.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;