Transcript | Ll_transcript_169194 |
---|---|
CDS coordinates | 1370-2074 (+) |
Peptide sequence | MDTFPQKLDLLLSDAASRFKDFKYGPEVLKEEVENYKRYAERLEPYIDDTVHVINDAIAQKKKILVEGGQATMLDIDFGTYPFVTSSSPSAGGICTGLGIAPRAIGDLIGVVKAYTTRVGSGPFPTELLGPAGDQLRSAGHEFGTTTGRPRRCGWLDLVALRFSCQINGFSSLNLTKLDVLSELDEIQLGVAYKHADGTTINSFPSDLDVLEQLKVNVPSFPFTAFLHLPPSSQ* |
ORF Type | complete |
Blastp | Adenylosuccinate synthetase 2, chloroplastic from Ricinus with 83.78% of identity |
---|---|
Blastx | Adenylosuccinate synthetase 2, chloroplastic from Ricinus with 85.71% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (8278953) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425935.1) |
Pfam | Adenylosuccinate synthetase (PF00709.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer