Protein coding transcript 231642

• Transcript: Ll_transcript_167733
• CDS coordinates: 1602-2108 (+)
• Peptide sequence: MIPVVCVMEWILHSKHYSREVKMSVMVVVVGVGVCTVTDVKVNLKGFVCACIAVLSTSLQQISIGSLQKKYSIGSFELLSKTAPIQAISLLVFGPFVDYFLSAKLITNYKVSSGVIFFILLSCSLAVFCNVSQYLCIGRFSAVSFQVLGHMKTVCVLTLGWRLFDSELT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_167733

• Blastp: UDP-rhamnose/UDP-galactose transporter 2 from Arabidopsis with 84.02% of identity
• Blastx: UDP-rhamnose/UDP-galactose transporter 2 from Arabidopsis with 76.73% of identity
• Eggnog: solute carrier family 35 member(ENOG410XP1S)
• Kegg: Link to kegg annotations (AT1G21070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413795.1)
• Pfam: Triose-phosphate Transporter family (PF03151.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;