Protein coding transcript 231653

• Transcript: Ll_transcript_167731
• CDS coordinates: 1-330 (+)
• Peptide sequence: ANTSITGMNLSLMLNSVGFYQISKLSMIPVVCVMEWILHSKHYSREVKMSVMVVVVGVGVCTVTDVKVNLKGFVCACLAVLSTSLQQIVSINHIMFLLNYVGNMGLFQF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_167731

• Blastp: UDP-rhamnose/UDP-galactose transporter 2 from Arabidopsis with 87.5% of identity
• Blastx: UDP-rhamnose/UDP-galactose transporter 2 from Arabidopsis with 77.17% of identity
• Eggnog: solute carrier family 35 member(ENOG410XP1S)
• Kegg: Link to kegg annotations (AT1G21070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453382.1)
• Pfam: Triose-phosphate Transporter family (PF03151.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;